PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf08488g03002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 581aa    MW: 64314.3 Da    PI: 6.7646
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf08488g03002.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.54.5e-083754052454
                               S--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                  Homeobox  24 ypsaeereeLAkklgLterqVkvWFqNrRak 54 
                               yp+ +++  LAk++gL+ +qV++WF N R +
  Niben101Scf08488g03002.1 375 YPTDSDKVMLAKQTGLSRNQVSNWFINARVR 405
                               9****************************88 PP

2BELL92.93.1e-30245314372
                      BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                e+++ k+kL+s+l+eV++rYkqy++q+++v++sFe v glg+a+p+++l lka+S+hF cLk+ai++q+
  Niben101Scf08488g03002.1 245 SEHRRNKSKLISMLNEVYRRYKQYYQQVEAVVASFESVPGLGNAAPFAKLSLKALSKHFSCLKNAITDQL 314
                               68999**************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.2E-40182312IPR006563POX domain
PfamPF075261.4E-34187311IPR006563POX domain
SMARTSM003893.1E-9356413IPR001356Homeobox domain
CDDcd000862.19E-12356410No hitNo description
SuperFamilySSF466892.61E-13358416IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.3E-20359413IPR009057Homeodomain-like
PfamPF059204.7E-13375405IPR008422Homeobox KN domain
PROSITE profilePS5007111.013375409IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 581 aa     Download sequence    Send to blast
MAEGFEAYHV PQQSRRDRLR VSASGLLPFV DHPSLIPSDF LLVSDAKEKG VNFMDPQLSS  60
RISFQEITGN PLLYSHQNFR FLDQSFHGGD VDVVYKQEPL SSVAAAPETN ICNNTSNNNV  120
TTGQGLSLSL SSCHHNHHYN NQSSSSSSNL PLELNLQRYD SSIFTNDMSS KSSATVPLGP  180
FTGYASILKG SRFVKPAQQL LVELCDVGRG IYVEKLAAND DSAVMDSSLE TPLSDDPQYS  240
CGDGSEHRRN KSKLISMLNE VYRRYKQYYQ QVEAVVASFE SVPGLGNAAP FAKLSLKALS  300
KHFSCLKNAI TDQLQHTGKS QNCESDHSFP RAGGKGIYCQ RSPIHSAGFV DHQPVWRPQR  360
GLPERAVTVL RAWFYPTDSD KVMLAKQTGL SRNQVSNWFI NARVRLWKPM VEEIHNLETR  420
QAQKAALQRE EQNNNNPIEH FPTSNSLPSE HPSTSSQQFQ DVPSKRTRNN DPNETHLGGD  480
PDQETMNLSY DNFSPHSRAG VVDQMSTASA GIGGVSLTLG LNQSNNVSIG LSGSFPRNAA  540
RRFGIDENNE GFMFGGFESQ NRQLGRDNNV IGEQLLHDFV G
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016477978.10.0PREDICTED: BEL1-like homeodomain protein 9
TrEMBLF6HL250.0F6HL25_VITVI; Putative uncharacterized protein
STRINGVIT_08s0007g01290.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35202237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.15e-89TALE family protein